General Information

  • ID:  hor000690
  • Uniprot ID:  P10093
  • Protein name:  Calcitonin gene-related peptide 2
  • Gene name:  Calcb
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNTATCVTHRLAGLLRRSGGVVKDNFVPTNVGSKAF
  • Length:  37
  • Propeptide:  MDFWKFFPFLALSSMWVLCLASSLQAAPFRSALESSLDLGTLSDQEKHLLLAALIQDYEQKARKLEQEEQETEGSRKGSSSSVISQKRSCNTATCVTHRLAGLLRRSGGVVKDNFVPTNVGSKAFGRRRRDLRV
  • Signal peptide:  MDFWKFFPFLALSSMWVLCLASSLQA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Calcrl, Ramp1
  • Target Unid:  Q63118, Q9JJ74
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-P10093-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000690_AF2.pdbhor000690_ESM.pdb

Physical Information

Mass: 451976 Formula: C166H275N53O50S2
Absent amino acids: EIMQWY Common amino acids: V
pI: 10.77 Basic residues: 6
Polar residues: 16 Hydrophobic residues: 13
Hydrophobicity: 4.05 Boman Index: -5697
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78.92
Instability Index: 4181.89 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  2994212
  • Title:  Expression in Brain of a Messenger RNA Encoding a Novel Neuropeptide Homologous to Calcitonin Gene-Related Peptide